Kemajuan Teknologi Mempercepat Penemuan Vaksin Covid-19

Kemajuan Teknologi Mempercepat Penemuan Vaksin Covid-19
Foto : Tim Komunikasi Komite Penanganan COVID-19 dan Pemulihan Ekonomi Nasional

JAKARTA - Pengetahuantentangselukbelukvaksinmemangbukankonsumsiorang awamselamaini. Teknologi, sumberdaya, daninfrastrukturnyahanyadiketahuisegelintir orang yaknipenelitidanprodusenvaksinitusendiri, sertakomunitasilmuan. Tidakpelakhalinimenimbulkankeraguan di benakmasyarakat, apakahmungkindalamwaktusingkatsebuahvaksinbisadiciptakan. Demi menjawabkeraguantersebut, dalamacaraDialog InspirasibertajukTata Cara PenemuanVaksin yang diselenggarakanKomitePenanganan Covid-19 danPemulihanEkonomiNasional (KPCPEN),Senin (2/10), telahmenghadirkan Prof. NgurahMahardika, AhliVirologiUniversitasUdayana yang mengetahuibetulselukbelukpembuatanvaksindariawal.

“Zamandahulutentuharusdapatagennyadulu yang murni. Setelahitudiperbanyak, dankemudianbarudisiapkansebagaivaksin. Itu yang menempuhwaktu yang lama. Zamansekarang, teknologitelahmemungkinkankitamelakukannyadengancepat. Tidakperlulagiagenpenyakitdanbisadibuatsintetis, jadibisasangatcepat. Zamandahuluperluwaktu lama untukmenemukanbibitnyasaja. Zamansekaranghanyaperluwaktusatuduabulansajauntukmenemukanbibitnya,” jelas Prof.NgurahMahardika.

Dalampemaparannya, Prof. NgurahMahardikamenyebutkanadasedikitnyaempatragamvaksinyang dibedakanberdasarkanbahandasarnya. Pertama yang berbasis virus murni yang dimatikansehinggatidakberbahayabagimanusia, ada pula yang berbasis DNA atau mRNA, ketigaadavaksinberbasis adenovirus, danterakhiradalahvaksinberbasis protein.

“Ragam basis vaksininipunyakelebihandankekurangantentunya, sepertivaksinberbasis virus yang dimatikan yang saatinidiujicobakan di Indonesia adalahjenis paling lazim, sehinggaregulasipenggunaanyajauhlebihringkas. Sementaravaksinberbasis DNA dan adenovirus memangbelumadacontohnya yang beredar di masyarakatsehinggaregulasinyamemakanwaktu lama,” terang Prof.NgurahMahardika.

Meskipunteknologimengakselerasipenemuanvaksinbaru, faktorkunci yang tidakbolehdikesampingkandalamproseduradalah, memastikantingkatkeamanannya. Padadasarnyapenelitidanpengembangvaksintidakmengkompromikanaspekkualitas, dayaguna, dankeamanannya, termasukkeamananvaksin Covid-19 yang nantihendakditemukan, harusterjamin.

“Untukaspekkeamananinidimulaisejakfase pre klinis, yang diujikanpadahewan, laluFase I yang melibatkanrelawanmanusia, Fase II yang melibatkanratusanrelawan, danFase III yang melibatkanribuanrelawan. Padasemuafase, aspekkeamanandandayagunamenjadiperhatianserius. Lebih-lebihpadaFase III, ketikamelibatkanribuanhinggapuluhanribu orang,” jelas Prof.NgurahMahardika.

Tidaksampai di situ saja, setelahberedar di masyarakatvaksinakanterusdimonitordandiaduitterusmenerusuntukmemastikankeamananvaksin yang beredartersebutnantinya.Perludiketahuijuga, bahwaIndonesia sangatmemungkinkanuntukmengembangkanvaksin Covid-19 secaramandiri. Namunkerjasamadalammasapandemi Covid-19 sepertisaatinibukanlahhal yang tabu. Kerjasamabertujuanuntukmendapatkan data berkualitastinggi. Penelitidanilmuan di Indonesia jugamembuka data-data kajiandalamnegeriuntukmemberisumbangsihkepadakeilmuanduniadanmenerima input positifdaripenelitiluarnegeri.

“Tanpakerjasamasayakirakitamampu, tapiuntukmencapaikemajuan yang pesatdirasaperludenganjalankerjasamaantar Negara dankeilmuandunia,” tutup Prof. NgurahMahardika.

Selainkabarbahwavaksin yang bisaditemukanlebihcepat, kabarbaik lain datangdariangkakesembuhanCovid-19 per 1 November 2020 terusmeningkat. Rasiokesembuhan(recovery rate)dariseluruh total kasus Covid-19mencapai 82,84%. Angkasembuhdanselesaidariisolasimeningkatdariminggusebelumnyayakni 80,51%. Kemudiantracingdantesting per 1 November 2020mencapailebihdari 4,5 jutaspesimendanbanyak di antaranya yang negatif.

Perludiingat, memakai masker, menjagajarak minimal 1 meter, danmencucitangandengansabun, tetapmerupakancarapencegahan yang terbaikhinggasaatini. Kita perluuntukterusdisiplinmempraktekkanlangkah 3M inisecarasepaketagar terhindardaripenyakit.

***

Tim Komunikasi Komite Penanganan COVID-19 dan Pemulihan Ekonomi Nasional